PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0013s0230.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARF
Protein Properties Length: 691aa    MW: 76586.6 Da    PI: 6.8349
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0013s0230.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3727.6e-23115215198
                             EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEE CS
                      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvF 82 
                             f+k+lt sd++++g +++ +k+a+e+     +++ + +++l  +d++g  W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF
  SapurV1A.0013s0230.2.p 115 FCKILTASDTSTHGGFSVLRKHATEClppldMSQATPTQELAARDLHGYDWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVF 201
                             99****************************9555566679*********************************************** PP

                             EE-SSSEE..EEEEE- CS
                      B3  83 kldgrsefelvvkvfr 98 
                                + +++el+v+++r
  SapurV1A.0013s0230.2.p 202 L--RGDNGELRVGLRR 215
                             *..3489999**9997 PP

2Auxin_resp94.22e-31241320183
              Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                             a+ha+ t+s F v+Y+Pr+   ++++ ++k+++a+k+ +svGmRfkm+fe+eds+err++Gt+vgv d++p +W++S WrsLk
  SapurV1A.0013s0230.2.p 241 ASHAVLTQSLFLVYYKPRT--NQYIIGLNKYLEAVKNGFSVGMRFKMRFEGEDSPERRFTGTIVGVGDFSP-EWSGSIWRSLK 320
                             68999*************6..99************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.57E-40106244IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.8E-39108230IPR015300DNA-binding pseudobarrel domain
CDDcd100171.37E-18113215No hitNo description
PfamPF023624.9E-21115215IPR003340B3 DNA binding domain
SMARTSM010193.3E-21115217IPR003340B3 DNA binding domain
PROSITE profilePS5086311.885115217IPR003340B3 DNA binding domain
PfamPF065072.2E-29241320IPR010525Auxin response factor
PfamPF023092.2E-11550662IPR033389AUX/IAA domain
SuperFamilySSF542776.41E-11569650No hitNo description
PROSITE profilePS5174524.801575655IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 691 aa     Download sequence    Send to blast
MAQTERGDDL YTELWKACAG PLVDVPKAGE RVFYFPQGHM EQLEASTTQE LNQQIPRFNL  60
PSKILCRVIN IQLLAEQDTD EVYAQITLQP EADQTKPTSP EPCPPEPAKQ TVHSFCKILT  120
ASDTSTHGGF SVLRKHATEC LPPLDMSQAT PTQELAARDL HGYDWRFKHI FRGQPRRHLL  180
TTGWSTFVTS KRLVAGDSFV FLRGDNGELR VGLRRLARQQ SSIPSSVISS QSMHLGVLAT  240
ASHAVLTQSL FLVYYKPRTN QYIIGLNKYL EAVKNGFSVG MRFKMRFEGE DSPERRFTGT  300
IVGVGDFSPE WSGSIWRSLK IQWDEPATIQ RPERVSPWDI EPFAAPSSPN LTQQVVKSKR  360
PRPVDIPASE ITANPAASAF WYHGPTQSRE LVQRGSIIEA QSSESHIWSM RQKEVDSSLN  420
NSGGCNSRAR PEGIWLPSSH MNVSLNFFPD PAGDNKCAKT QSIISGFASS ISSMQSDGLI  480
NEQVEKGRKF ENSVGCRLFG IDLTSNSGIT AAPEKEPAYP IVDYNEAKGL FPAAGEAEKA  540
QTMEFSMSSK QQKQVVPDAL AKESQSKQGS TTSTRTRTKV QMQGVAVGRA LDLTVLKGYK  600
DLIIELGKMF EIGELSTREK WTVVFTDDEG DMMLVGDDPW PEFCKMVKKI YIYSSEEVKK  660
MSARCKLPAS SFEGEGTAVS MESEHKSDAA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-173834317355Auxin response factor 1
4ldw_A1e-173834317355Auxin response factor 1
4ldv_A1e-173834317355Auxin response factor 1
4ldx_B1e-173834317355Auxin response factor 1
4ldx_A1e-173834317355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1358362KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT1646980.0KT164698.1 Populus tomentosa clone Potom.002G07206 auxin response factor 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006375372.10.0hypothetical protein POPTR_0014s09560g
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLU5FSL20.0U5FSL2_POPTR; Auxin response factor
STRINGPOPTR_0014s09560.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9